PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC019292.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 224aa    MW: 23452.6 Da    PI: 6.7173
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC019292.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.75.1e-3260115359
   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                   +vrY+eClkNhA+ +Gg avDGCgEfm++ geegt +alkCaAC+CHRnFHR+e+++
  EcC019292.20  60 SVRYRECLKNHAVGIGGSAVDGCGEFMAA-GEEGTFDALKCAACNCHRNFHRKETDS 115
                   79**************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.9E-2961113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257744.0E-2362115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.7E-2962112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.64563112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.8E-8190224IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0003677Molecular FunctionDNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MEFDEHEDQD EEMEIPVHHH QAAPAPVGYD SLGNPGRPSG SGAVGEGGAS AAPRKSASAS  60
VRYRECLKNH AVGIGGSAVD GCGEFMAAGE EGTFDALKCA ACNCHRNFHR KETDSGDGGG  120
ALVSYHHPHH HPGQQHPQFS PYYRAAPSPA GYLHLTPPQQ QHRPLALPAA SGGGHSREEL  180
EDVSNPSSSG GGGGGGGGGS GLKKRFRTKF TPEQKEKMLG FAER
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188199SGGGGGGGGGGS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010060081.11e-133PREDICTED: zinc-finger homeodomain protein 2-like isoform X2
SwissprotQ6YXH51e-48ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A059BKP61e-133A0A059BKP6_EUCGR; Uncharacterized protein
STRINGPOPTR_0005s17620.12e-64(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.19e-41homeobox protein 22